LL37 5MG

Choose: LL37 5mg (x1 LL37 5mg vial) or LL37 5MG Starter Kit Everything you need to get started straight away! (x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes, x10 alcohol wipes) KEY HIGHLIGHTS Purity: >99% (HPLC Tested) Form: Lyophilised Powder Packaging: Sterile 2ml Vial Intended Use: For

This product is currently out of stock and unavailable.

Choose:

LL37 5mg (x1 LL37 5mg vial)

or

LL37 5MG Starter Kit 

Everything you need to get started straight away!

(x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes,  x10 alcohol wipes)

KEY HIGHLIGHTS

  • Purity: >99% (HPLC Tested)

  • Form: Lyophilised Powder

  • Packaging: Sterile 2ml Vial

  • Intended Use: For laboratory research use only. Not for human consumption.

  • Storage: Store below 25°C, away from light and moisture.


PRODUCT OVERVIEW

LL-37 is the only known human cathelicidin peptide and is widely studied for its broad-spectrum antimicrobial and immunomodulatory activity. In research environments, LL-37 plays a significant role in innate immune response modelling, making it a popular compound for investigations into inflammation, wound biology, and cellular defence mechanisms.

Due to its multifunctional nature, LL-37 is used across a wide range of experimental models — particularly those involving tissue regeneration, microbial interaction, and immune signalling pathways.


POTENTIAL APPLICATIONS (RESEARCH ONLY)

In controlled laboratory settings, LL-37 is commonly researched for:

  • Antimicrobial activity across bacteria, fungi, and biofilm models

  • Innate immune function modelling

  • Inflammation and cytokine response studies

  • Tissue repair and wound biology mechanisms

  • Cellular defence signalling pathways

  • Skin and epithelial barrier research

Note: This compound is strictly for laboratory research. No therapeutic or medical claims are implied.


STORAGE & HANDLING

  • Store below 25°C in a dry, dark environment.

  • Keep vial sealed until use.

  • Reconstituted solutions should be handled aseptically.

  • Avoid repeated freeze–thaw cycles.


SOLUBILITY & STABILITY

LL-37 dissolves in sterile bacteriostatic water under laboratory conditions.
The peptide is sensitive to oxidation and prolonged exposure to room temperature; store reconstituted solutions appropriately to maintain stability.


TRUST & LEGITIMACY

  • COA Included: Certificate of Analysis available for each batch.

  • Lab Verified: Tested via HPLC and Mass Spectrometry.

  • Compliance: Manufactured and sold strictly for scientific, research-only use.


DISCLAIMER

This product is intended for laboratory research use only. Not for human consumption, medical use, veterinary applications, or household purposes. The purchaser assumes all responsibility for proper handling.


ATTRIBUTES

Attribute Detail
CAS Number 259061-43-9
Purity >99% (HPLC)
Appearance White Lyophilised Powder
Molecular Formula C₅₂₀H₉₇₂N₁₇₂O₁₆₇
Molecular Weight ~4493.3 g/mol
Sequence [LL-37, 37 aa]
Form Lyophilised Powder
Packaging Sterile 2ml Vial

At NeuroGen Research, we aim to deliver your order quickly, safely, and reliably. All orders are shipped from our Sydney/Melbourne locations via Australia Post Express for fast, tracked delivery.

Shipping Rates

  • Free Express Shipping – Orders over $200 AUD
  • Flat Rate Express Shipping – $14.95 AUD for orders under $200

Delivery Times

  • Metro Areas: 2–4 business days
  • Regional Areas: 3–5 business days

Delivery timeframes are estimates provided by Australia Post and may vary depending on your location and seasonal demand.

Dispatch Times

  • Orders placed before 12:00 PM AEST are shipped the same business day
  • Orders placed after 12:00 PM or on weekends/public holidays will be dispatched the next business day

Tracking Your Order

Once your order has been shipped, you will receive an email with your Australia Post tracking number. You can track your order via the Australia Post website.

International Shipping

We currently ship within Australia and New Zealand only.

Order Issues & Delays

If your order is delayed, lost, or arrives damaged, please contact us within 48 hours of delivery so we can investigate and arrange a replacement if eligible under our Quality Assurance Guarantee.

Intended Use:
This product is intended strictly for qualified laboratory researchers. It is not for human or veterinary consumption and must not be used as a drug, food additive, cosmetic, or household item.

Disclaimer:
This compound is sold for in vitro research and educational purposes only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.

Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. NeuroGen Research and its affiliates are not liable for any misuse or mishandling of this material.